DPCstruct | MC54850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6WA57 | 1-75 | MKKTRKVYVGDVAIGGGSPISIQSMTTKETKNIEEVVKQINDFEKAGCDISRSAINSLEDARAISEIKKERIFLL |
| A0A379SSK1 | 3-69 | IGDGAPITVQSMTNTRTTDVEATVNQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVSVPLVADIH |
| A0A1E3H8H3 | 2-97 | None |
| A0A2T6EPI0 | 1-66 | None |
| A0A5A7N034 | 1-88 | None |
| A0A7J6Q3W5 | 136-201 | None |
| A0A2S2CNW3 | 471-552 | None |
| A0A6D2HVJ8 | 40-114 | None |
| M1VIF2 | 93-191 | None |
| A0A0M2UUS9 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.