DPCstruct | MC5485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 161 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7NLV1 | 1-194 | MMRKYPVRFGGRGRCVLSRGASPRPNRDLKALGLYIARALSFAGVEYDVLRHTLTPEQIAIYDQYAQGWEIIHRNMEEALALTGVVD… |
| A0A6J1R045 | 505-652 | MDMKLRGMYIARQLSFHGVAFKIEEVPLSKDFTKVYDHSVRLWVEAMQRFQEAAESIGAENRMKKTMWGQFWSAHQRFFKYLCIAAK… |
| A0A287XFG3 | 329-490 | None |
| A0A4S4DW11 | 442-602 | None |
| A0A1R3I5I6 | 265-413 | None |
| B4K363 | 521-671 | None |
| A0A287J5L4 | 378-538 | None |
| A0A183GCG9 | 448-614 | None |
| A0A1D6JDZ7 | 120-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.