DPCstruct | MC54849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 230 ± 36 aa |
| Standard deviation of domain lengths | 35.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6C3E3 | 7-253 | QDKLFQNWIKCSHALKLLQSPLERFIGVELEKFHQVLLRECGMGRCVKKCQFTKWKPGSSKIPPLDCQVCSCWRDEILAYHTNPRGK… |
| A0A8B6GZU5 | 138-337 | SKDLPDEIDEREKRWLIVGICLHTIISPVLRKYVVPVVTRLFFSLISRNKIHKQTYENHLKIFDLTNTELNYEVINNNKPKYGSDRA… |
| W5M2Z9 | 17-257 | None |
| A0A2B4S582 | 2-225 | None |
| A0A2B4S7G5 | 24-292 | None |
| A0A2B4SD90 | 22-267 | None |
| A0A6S7GCF6 | 430-637 | None |
| A0A7D9L7C4 | 2-234 | None |
| A0A7D9MJ99 | 5-195 | None |
| A0A8B6EZM3 | 253-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.