DPCstruct | MC54848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 129 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6BSX8 | 1-133 | MADEEADQDRSPENGISETIWELRQRLQELQEIVVRESDDSSVQSSSEYCQEFCRTLLEYAGRWKIEEEPLPLVEVYIVALLSYAQA… |
| A0A3B5Q569 | 1-132 | MADEEAEQDRGLVDNISKTIGEVRNLLEGLHEVVIRESANSPVQSSSDYCQEFCRTLLEFVGRWKTEEEPLPLVQVYMVALLSFAKA… |
| A0A7J8KFM2 | 33-158 | None |
| A0A673HDW5 | 2-133 | None |
| D3ZJX1 | 16-136 | None |
| A0A151PG42 | 2-115 | None |
| A0A4W5PPS6 | 2-138 | None |
| Q9Z2U2 | 1-132 | None |
| A7MBU1 | 2-133 | None |
| A0A3S2NV83 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.