DPCstruct | MC54846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673HW95 | 11-171 | TWTAYQNANIFNQLQTLTDIIQKQQNEELRRLLPANCPAPDVPEDGGLLCVSVKNKAYCKPMCNAGYDFSFIRRSRLFEECSSATQD… |
| A0A4W6BKI9 | 16-176 | TLTAQQSAALLLLVRNLADSLHKHQLKDCQGSEPKNCTEAEVPKNGGLACVTVANKRYCKPMCNYGYDFNFLRRSRLFEECSEQTGH… |
| A0A6F9DCB4 | 299-427 | None |
| A0A3P8WVA5 | 54-213 | None |
| A0A6P4YK21 | 73-207 | None |
| A0A3B1JMW4 | 111-276 | None |
| A0A3Q3AWU9 | 8-147 | None |
| A0A1S3JU74 | 713-839 | None |
| A0A6S7HB90 | 132-262 | None |
| A0A6P8HGQ6 | 120-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.