DPCstruct | MC5484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 208 ± 32 aa |
| Standard deviation of domain lengths | 31.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S1N631 | 25-241 | HQTLSQQQRTAFYLELSAEQQIQLEHHRKYELRSRFTTYDYLKATNWQFDEYIVDYHYPHSNPGLHCQCGKKLKYQFILVSKDHQEK… |
| A0A1Q9FU93 | 6-204 | SFLNEEQKKFLMDYVKTKKVDAFNKVQKVAAIGNEGLENASSEDMQLLIDEWVLIDYIDNGFVNNNTPCECGRPLRYQYIVKNNKSG… |
| A0A4V2E0L9 | 16-205 | None |
| A0A7X4I784 | 3-245 | None |
| A0A1Q9PI00 | 2-202 | None |
| A0A0R1ZWN1 | 4-191 | None |
| A0A5B8TK97 | 6-204 | None |
| A0A1R1CW34 | 1-204 | None |
| A0A242L903 | 11-219 | None |
| C3GTL9 | 1-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.