DPCstruct | MC54836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T2CG23 | 1-118 | MKRTLFQFSFTTNRQCDNENEDNVNGDSESESDSNQTDGPSRSKKTKVKKTFQTSWLAKWPWLRKDEKGMKCKVCLDHKKANTFTGS… |
| A0A182GCD6 | 129-242 | ADESLLEEMIRPPPAVHTKPQTPRQTSRSSSTSSSSSRKGGRFRPNWLEQFDWLKYDEEKNYMYCAFCRRWSNDIPDIRTSFVEGNS… |
| A0A6J8AWP1 | 1-162 | None |
| A0A6J8EHX8 | 1-115 | None |
| A0A182KC60 | 93-224 | None |
| A0A653D7M0 | 453-573 | None |
| A0A6J8DJM8 | 1-124 | None |
| A0A7I0Z3N1 | 327-439 | None |
| A0A1D1W0A9 | 94-233 | None |
| A0A2I1FNM9 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.