DPCstruct | MC5483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7ZYN5 | 177-283 | WNVLKSFVDPRMAEKLVILKSAEVYSTLEKYIDHVNIPKQFGGELAFQHGMLPDLDEGIRQTLFWIDSKNRLPPGPLKWVQDGGNRK… |
| A0A4V2ER31 | 1-124 | MWNLVKRWLDPRTASKFTIVPAADTLRILEESIDIQNIPTLFGGNFSFQHGMQPKLERAIMRSLTLTASLVAQLPPGPIQLRHEDGR… |
| A0A1V6SH07 | 96-197 | None |
| A0A6A6GFB3 | 243-365 | None |
| A0A5N6KT61 | 107-234 | None |
| F7WBX6 | 148-245 | None |
| A0A0A2KUN8 | 1-111 | None |
| A0A3M7M5F1 | 127-235 | None |
| A0A4U0WXR2 | 254-366 | None |
| A0A4V5NFP4 | 638-764 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.