DPCstruct | MC54826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF06417- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218XPA8 | 14-162 | WAVEFTDASAAPSSRDDDSSVSRQKKDAEANWKSQKAWEVAQAPFKNLMMMGFMMWMAGSTVHLFSIGITFSALWQPISALQGVGKV… |
| A0A0C3CZD2 | 1-98 | MSGGGVQIFSIGIVFMLLLTPFKNIAGINEAFAQYAPSSKSPHSITTLPLHKIVYIMCNLLTLAVGLWKCRSMGLLPTGTGDWLAFE… |
| A0A5J4YNA6 | 86-215 | None |
| A0A3P6CTB6 | 14-182 | None |
| A0A0G4HT37 | 21-176 | None |
| A0A2H5NWK1 | 11-181 | None |
| A0A1R3J746 | 590-753 | None |
| A4RYK5 | 7-133 | None |
| A0A0B7N2D7 | 3-121 | None |
| A0A0A9NLR2 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.