DPCstruct | MC54822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0AMA0 | 3-115 | STTITPQPSFYEDYEKGEEPTNWLRRYELLLPTTTTDTDKLTHFELQCAAASPVENWYVNLPTMDKATWVAFQAAFRARWPQPTQVA… |
| W4JVR9 | 351-464 | AMPANPPSTWFYGDGRTCENPGDFIKQVEQGFTEKSTDTHKVDKVGQYLKSGSPAEKWYEDELSPVDSATWKSFKAAFFTRWLKLKA… |
| A0A0C3MYD3 | 130-239 | None |
| A0A4S4LNW2 | 8-123 | None |
| A0A0C9UWM6 | 240-374 | None |
| A0A4S8LIZ0 | 2-130 | None |
| A0A0C3B4U2 | 10-125 | None |
| A0A0H2R796 | 67-191 | None |
| A0A0C9U7G1 | 3-143 | None |
| A0A0C9YXU9 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.