DPCstruct | MC5482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8YY47 | 1-114 | MTANECYRPPVDAQLRYTVQWFHEWSEMQRGDFLPVLAQKLAPGSYVNGLLAGVETLSCNENGRPPSLFQCRVKLFRDWFETWSPAE… |
| A0A1B6DWX9 | 5-121 | NGYVPSTQAQLGYIGQWFHEWSEMQRNDFLPILAQKFGTKGYVNGLLPGLEALNSFEDRPPSLFQCRIKLFREWSDNWSQVEKEQLL… |
| A0A2T7NZX7 | 1-135 | None |
| A0A182IQG9 | 64-178 | None |
| M3ZDV0 | 77-192 | None |
| A0A194PHZ3 | 1-130 | None |
| A0A182QRE1 | 111-229 | None |
| A0A665X3Y7 | 38-158 | None |
| A0A4D9DR43 | 1-114 | None |
| B0WQE5 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.