DPCstruct | MC54819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 242 ± 47 aa |
| Standard deviation of domain lengths | 46.52 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0A6W4 | 32-252 | VAVPGRPYRQPSALASEQRCFPEEKQDDEQRDAVFLEDFAFFDKYKRMVHLPCEYTEADIFGAGKAYLEEYGPTYIAIGPIHQYSIE… |
| A6QYY8 | 17-218 | TDENDWEEFALTDVKVLVPGKTRYANVLFASVNNPVRVTGQLEIVEEEQEELVLDDSYRNKRVLIDNVTHYAYGQHDDGEIGLWVAG… |
| A0A1Z5T8Q1 | 3-238 | None |
| A0A7N2L3M1 | 1-249 | None |
| M1VIW7 | 2-265 | None |
| A0A6J0JAN2 | 234-490 | None |
| F4PZN3 | 132-419 | None |
| A0A1I8FMJ8 | 3-188 | None |
| A0A803KRA3 | 1-257 | None |
| A0A1D6F9I7 | 2-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.