DPCstruct | MC54807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 210 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0RBD8 | 1-209 | MTPYDEYFAKIDAMKQKDPNILGPMLIRGIPQHSNDSDEEAEVDSDEEENEDSNSKYTAEQMSTLRHVLITQKRNDRLDEMREYVLG… |
| A0A7S4LQF5 | 60-267 | DMTEEKLTTFTEAYKKFCEERDTESGEDRVCLVFGTPTDIRPVPQTAEEFKAKTPYVFLDAAGQDFMETFGEKYMMAFAANMPEEED… |
| A0A812IEP3 | 124-361 | None |
| C1EDJ1 | 59-239 | None |
| A0A1Z5KAJ5 | 1-212 | None |
| A0A1E7FXH6 | 95-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.