DPCstruct | MC54800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2GL12 | 233-327 | QIDDPEILAELSAQLQRQLEGAFGEGEGLVYAAIVVRDGQLHSYQPINGAAHDLGESTPLARFGMISLAGEGLEVPHARLQIIVSPS… |
| A0A6B3P8Y9 | 205-305 | IAKKITNKTELLELKQKLYNTIDQTWKTPINITSIYLVKVDKNGAIAAYEAFNQIATDNLEKTPIPSLVNSDATTQKELLKTEWAEF… |
| A0A7X6HNR2 | 266-374 | None |
| A0A2T1BXN7 | 611-727 | None |
| A0A3S1AI09 | 386-485 | None |
| A0A845YCQ5 | 440-555 | None |
| A0A349JEV1 | 2-85 | None |
| A0A6P0WVY5 | 249-356 | None |
| A0A2T2RNN1 | 447-592 | None |
| A0A0M1JZ62 | 408-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.