DPCstruct | MC548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7D9F1 | 12-125 | LLAATQVTAATNRDICWSKNRNVVEAVDAFCNSKSNIVVPSDYAKKGGMAKKRTGSRAAKVSIGGNCKPPQWVPQKYCKSQFMGMCA… |
| A0A4U0Y336 | 7-111 | QNGVTCGAKNPAVNMAIDNFCNRENAQHQVTNNLTIGLPWARNGVLHDGFKVNIVGPTCPANSRWVPAKYCNAQFHYLCANAGGPMG… |
| M3BT33 | 9-116 | None |
| A0A6A6BZ37 | 38-166 | None |
| A0A074YGT3 | 74-180 | None |
| A0A1V8VA06 | 35-149 | None |
| M3BT27 | 4-123 | None |
| A0A2K1QWV0 | 3-120 | None |
| A0A3M7DWS4 | 13-131 | None |
| M2ZXM2 | 260-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.