DPCstruct | MC5479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PL95 | 3-99 | SEELDPVDEFVPGTSQKAGVDFRSSVRRYITTNTELYERILRYEPIWLEELTKELKSQGLKFNSNQLMDYLDEQCITFRTAQGQRNR… |
| A0A6A4WV66 | 1-86 | MSVCLYASSAAALPERLRAYILSRPELYHQVLTYEPVWLESLHRDLRQNGIKLSMAQLMDFLDEQCITFRTENSGRRRKSPKKKKS |
| Q8C949 | 134-250 | None |
| S4RAE5 | 90-205 | None |
| A0A067RPP1 | 305-391 | None |
| M1V550 | 292-389 | None |
| E2BQ49 | 1097-1185 | None |
| A0A1S3IMR4 | 182-293 | None |
| A0A397UPH4 | 188-295 | None |
| A0A2I0T1U0 | 11-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.