DPCstruct | MC54786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 21.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0PA86 | 30-193 | QTFKQVAAPIYLQYYRVTDPDTRSAGDYIADGNLWQGIKWPVNETTAKGSGVKVTVDGYLESYAKVRVFQASAPKPIAYAKIQKTTV… |
| A0A0R1YU61 | 72-224 | FAPYRFKLPVRARVMQVGSGYTNQAASNYKPIFYITMDGYLQYYSGARLKHYDIKNSFESKSGSQDENPLWRIKPTTMVKINHFKTT… |
| A0A4R5NSX7 | 8-139 | None |
| A0A1W6NBZ0 | 1-116 | None |
| A0A0R2LUY4 | 247-401 | None |
| A0A0R2LTX9 | 85-270 | None |
| A0A0R1VYZ0 | 55-203 | None |
| A0A660DUQ5 | 467-614 | None |
| A0A0F3RUN4 | 173-312 | None |
| A0A0R1GSH2 | 120-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.