DPCstruct | MC54781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832RAJ3 | 162-239 | DRFDIDPRALAEQDLELMVRLAEIARLIEGSEATFLINARSDAEGRWIYKVMREAVGGYRLRGNIDISSTPNILVTLP |
| A0A7W8UVI9 | 1-88 | MKFDIPADALGARDPQLTTVLAKAGALAAAQKQPTVIRVTALGQDFKYINQAIWRGVPQQGLKPTLENLTTGANQTYSVSIQPLHAGS |
| A0A1H1K9V0 | 21-121 | None |
| A0A3E0CAH2 | 39-125 | None |
| A0A3D8JZ34 | 9-108 | None |
| A0A0Q9PUD7 | 141-221 | None |
| A0A3B0XC76 | 105-189 | None |
| A0A3B8U0Q0 | 73-199 | None |
| A0A5E4TRU7 | 58-166 | None |
| A0A653M665 | 233-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.