DPCstruct | MC54763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3DEL2 | 1-122 | GTAIILAIVLATVLYVAGTHWGVFLTFLALSVLSILALTLLAPHRMVRVQAWLGDCSDATDPCFQPAHGMYALASGGWWGAGLGQSR… |
| W1VPX0 | 6-129 | FAGLVLLSGVSWKIIIPIFVAVVSAIAGFLTIFITKDGRAFMHQIGMPTYQINRILAWLNPFDYAQTTTYQQAQGQIAIGSGGIFGQ… |
| D0WCX5 | 124-256 | None |
| A0A0U0W455 | 3-141 | None |
| A0A4U9TYC4 | 38-192 | None |
| A0A0A2WJH9 | 917-1074 | None |
| A0A2R7S7F3 | 6-116 | None |
| A0A7V3K291 | 3-134 | None |
| A0A2S1JYL0 | 98-250 | None |
| A0A1Q7Z2Z6 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.