DPCstruct | MC5476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 207 ± 29 aa |
| Standard deviation of domain lengths | 28.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DJ75 | 9-208 | HSNLQSSDQSEGSKSPSGENFSIDFNKMADAAAQALEADSGNNEFTAAIAQTLKNLTENTENLQSQFGDPDDIATMFENLGLNATDA… |
| A0A0N4U606 | 38-249 | IDLMMASYDEAAAEKAAKNFDSIIKDINERITHEQKKTCDSRGNIRMTEEERKAAENFQNMLKVLVEAEESAEKMEDGTGDVDVASM… |
| A0A177TGD0 | 90-328 | None |
| S3C5U6 | 256-489 | None |
| A0A0P1B5R2 | 101-258 | None |
| A0A438N3D7 | 210-403 | None |
| I1CSE2 | 54-260 | None |
| C4JZA0 | 19-247 | None |
| A0A2K8DP98 | 12-226 | None |
| A0A7J8V2V4 | 7-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.