DPCstruct | MC54758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 78 ± 16 aa |
| Standard deviation of domain lengths | 16.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.67 |
| Pfam Score | 82.57 |
| Assigned Pfam label(s) | CL0123- PF05180- PF08069- CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1EPA9 | 29-95 | GRMHAPGKGLSQLALPYHCSTPIWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQSLIHRL |
| A0A822ZCE0 | 1-88 | MHSRGKGISTSALPYKRTPPFWLKISSQDVEENICKFAKKGLTPSQIGVILHDFHGIAQVKSVTGNKILRILKAHGLAPEIPEDLYHL |
| A0A4Y1QZW5 | 2-79 | None |
| A0A166C8R9 | 1-92 | None |
| A0A212CF44 | 1-50 | None |
| A0A146HBY4 | 83-173 | None |
| A0A7R9ACI1 | 435-523 | None |
| A0A5A7VKU6 | 66-160 | None |
| A0A816JLZ1 | 26-116 | None |
| A0A5N5KQC3 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.