DPCstruct | MC54750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 436 ± 38 aa |
| Standard deviation of domain lengths | 37.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0RR93 | 53-519 | QYYQKVLSGEGEGAKRLHQSLAAFLNTEDPQERSIYRNRIITASWEVASSIAPKITRRDLPLPKRLFLRFGILLPTLLSEEQREMFS… |
| A0A7Y5BKW0 | 253-675 | QPELRNCLNRILDYSEIEVSKRNIFLENLDIFRNLKDKFSNIEAARVVRSNISLLFFPIYEQIFKKFLKDKNAPECIDNFLEYCFMD… |
| A0A3R6P9K7 | 89-506 | None |
| A0A098QYR4 | 495-958 | None |
| A0A1F7WZD9 | 3-474 | None |
| A0A832JUL3 | 5-472 | None |
| A0A7X8J060 | 2-339 | None |
| A0A1F6L8N4 | 156-565 | None |
| A0A2N1RQP8 | 345-787 | None |
| A0A352M373 | 7-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.