DPCstruct | MC5474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 154 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 65.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452R4J6 | 1-135 | MSLVFLFFFRSGRRASEEVEDHRLRQQSLDGSDDGGDIPVIPDLEEVQEEDFALQVAAPPSIQVNRVMTYRDLDNDLMKYAAFQTLD… |
| A0A1B6DCF7 | 18-166 | EPSIPPRSRKNGGWADDDVSKTNKSKRNSTNLIEQERFKSPDRQSKDDSDDDIPLIPDLDEIQEDEILCKVADAPFVAGNKVASFTE… |
| A0A673K169 | 13-168 | None |
| T1JGE3 | 41-202 | None |
| A0A7S2Y124 | 29-183 | None |
| T1K930 | 45-213 | None |
| A0A1S3WKX1 | 109-264 | None |
| A0A7R9FGA7 | 252-403 | None |
| A0A7R8W564 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.