DPCstruct | MC54738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 260 ± 52 aa |
| Standard deviation of domain lengths | 52.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8QGL6 | 23-248 | HDLYTVAAGLYGCWILLKLFFLVLEYAPQGTFFLFSAFRNMALTAVKLCAVSVPILIVIPLLAGISFHLAVISPIRIALHQTSLLFP… |
| A0A6A4X9C3 | 132-368 | DGPAHELYTAACGLYASWLAVRLAVLAASWLPLGWSGVYARLRQWAVAALRALVALVVLVGVIPLCYGLLLEVVVIVPIRVPLNQTP… |
| A0A446JEP3 | 293-544 | None |
| A0A7M7GFY8 | 858-1109 | None |
| A0A453SAM9 | 21-289 | None |
| C1HD92 | 1379-1640 | None |
| K1PGE1 | 649-874 | None |
| A0A7S2YUA8 | 8-204 | None |
| U7PSI9 | 1638-1939 | None |
| A0A811PNY6 | 777-1039 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.