DPCstruct | MC54734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6PYV0 | 1-149 | MECTHHLRCSEADRIRWFELREHVHNLIELGNIAREDGYIIEKTKLRHSLRYRDYLCAEYRTSGYLLYNDSSYHLQVACMWVGGEMN… |
| A0A1I7W0J7 | 5-142 | ILGDTNRDILCTDSLTCNEHHRLWWLHMRNHANNIQQFMEHKRYKNEIEGNELSVYSLKMRYILCKEVQSVGFMIDTRNDQWPLRCL… |
| A0A0N5D7K1 | 19-205 | None |
| A0A4U5M8C2 | 33-212 | None |
| A0A4U5M7Y5 | 102-280 | None |
| A0A090L260 | 172-331 | None |
| A0A0K0FLH1 | 57-229 | None |
| A0A0J9XZR4 | 23-148 | None |
| A0A183DIL7 | 8-151 | None |
| A0A7E4V2C9 | 25-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.