DPCstruct | MC54732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6PNG1 | 1-130 | MSQFIKITDQYTYLFSLCICNKVLIYCLGIGQLIVAAFSLAQHFVSVIQFGKIFKCSFNGSTNGSNDAGKKFLSHDMIIFDFGLFHE… |
| A0A183BUW5 | 1-125 | MKNKYIVIRDEHSKLFGHRFLNSQLSLYLGSIQLLFCLWALTQHIWSMASLNKILYCDFSPNSTLPPLLTHVDAIIFDIGLFHNLWG… |
| A0A183UDH4 | 3-124 | None |
| A0A1Y3F0H8 | 1-131 | None |
| A0A0B2VZF0 | 89-210 | None |
| A0A6V7WP16 | 1-125 | None |
| A0A811KPW9 | 2-93 | None |
| A0A0N4YEM1 | 6-120 | None |
| A0A2A2L912 | 49-165 | None |
| A0A6G0US26 | 40-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.