DPCstruct | MC5473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 10.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177B8D8 | 188-314 | QKFTSKAVKSAAKFNSLLQNRRLKDHKSYLDFQTFNIHYPQLPSKLTGSLKPDDYAISMVPQQYQNYYKEYTSQELKDLPLKTVTSK… |
| A0A0D6LEC8 | 46-160 | DVKKLAELREKAIKSAAEFNRELQQTKKLERQHYWDVQTSIIQSSTNKWKKLPAKYTKPDPYPVALIHGQYQNYYRKFTPGELRRLP… |
| A0A6A4W3A2 | 272-389 | None |
| A0A0B2V5E5 | 298-443 | None |
| A0A834M3H2 | 550-684 | None |
| A0A0N4U286 | 218-361 | None |
| A0A2G8JI61 | 494-615 | None |
| A0A6G1S370 | 6-143 | None |
| A0A0R3R6P9 | 143-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.