DPCstruct | MC54728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498IA63 | 114-187 | GLKIKFLDTAYFGGFCEPSKDLNRVCTIHANCCKGLDSKLHDLRIMVQNWKLSVSLPPNLKRYLMLPWVVPHNC |
| A0A3L6RHV0 | 64-141 | SKLQGRIEALETAYFSGFCEFHDDLNKVCTMHANCCIGLENKVLDLRDKAADWRNYTALTPEERKKGVFNKWTPPARC |
| A0A438EB79 | 153-220 | None |
| A0A438JRC7 | 215-287 | None |
| A0A0A9EUJ1 | 88-154 | None |
| A0A6J5WIS4 | 44-124 | None |
| A0A835HWZ6 | 478-564 | None |
| A0A0S3TBR5 | 46-126 | None |
| B8ANP0 | 183-258 | None |
| A0A0R0G2E9 | 359-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.