DPCstruct | MC54727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 269 ± 50 aa |
| Standard deviation of domain lengths | 49.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497ABT9 | 143-397 | RVELLQRMLDATSDEALEAIIRENDASIDADFFRLLTMNVEIAQATGRATDVQRFLALRDKLLELSSEGQAARARREMLEALRAEPT… |
| A0A3N7FBY8 | 25-299 | TNIFFSSLNDEKLPSTTLKTPLSVSPHRHKTAATQIFKTSFKANSSIANAEVPVEVEVEVEVEVAEGYSMTQFCDKVIDVFLNEKPR… |
| A0A1F8PPT9 | 7-265 | None |
| W7TEP8 | 21-422 | None |
| A0A7R9WBE0 | 4-266 | None |
| A0A7I4F0W2 | 78-304 | None |
| A0A5B6WEI7 | 3-191 | None |
| A0A2J6JUW8 | 2-227 | None |
| A0A2U1QD28 | 307-611 | None |
| Q0J6H1 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.