DPCstruct | MC54726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.18 |
| Pfam Score | 65.77 |
| Assigned Pfam label(s) | CL0395- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7F955 | 1-124 | MSIKSIVRELKEMKDGIGNISRRGLEGKHWRGRARSHIAPDETPAETDQIEQGQWANLPPELLLDIIRRVEESETSWPARAVVVHCA… |
| A0A0D3C4R1 | 1-97 | MTIRSLIQEMRSRPHRVVHEAASTTPVSEPFRWSELPDELLREILIRVETADDGDWPSRRSVVACAGVCRVWRMMVKEIVAVPELSS… |
| A0A4Y1QW46 | 30-173 | None |
| A0A6A3CEJ8 | 81-226 | None |
| A0A453HMG2 | 1-146 | None |
| A0A6A4NP25 | 29-166 | None |
| A0A2G3D7R2 | 2-124 | None |
| A0A6A3AQY6 | 16-134 | None |
| A0A1D6NFY3 | 1-127 | None |
| A0A7I8J019 | 14-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.