DPCstruct | MC54721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 180 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SK60 | 5-157 | EEMSDEEMDVDELEKRMWRDKMRLKRIKELQKDREMRSGTGHKQSQEQARRKKMSRAQDGILKYMLKMMEVCQAQGFVYGIIPEKGK… |
| A0A3N7E6L0 | 36-202 | DIRCENIAEKDVSDEEIGAEDMDRRMWKDHVKLKRIKERQKLAVQLAEKQKLKRTYDLARRKKMLRVQDGILKYMLKLMEVCEARGF… |
| M4DUF3 | 17-200 | None |
| A0A443N8J8 | 122-312 | None |
| A0A3P6BJA4 | 14-162 | None |
| A0A445BP54 | 1-169 | None |
| A0A833RDL0 | 31-226 | None |
| A0A0B0MZA8 | 12-193 | None |
| A0A833VNY2 | 57-246 | None |
| A0A0K9QM86 | 29-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.