DPCstruct | MC5472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1XCJ1 | 1-105 | MAIPLFSLQLRHSIIPHLVTIGKYDGSHHCLTAATSENKILIHSPHRPEKDISYLNINQKITALVAGKAIPNDEKDILVVGTVGSVL… |
| A0A1B6D4U4 | 5-112 | MAIPIFTLNLGHFILPGSVTIGKYDGSHSCLTAATIGDKILIHNPHRHDRKTSLLNVNQGIRAICAGRLNLDDEKDILAIGTPTSLL… |
| A0A7R9P0T6 | 1-119 | None |
| A0A401S7W6 | 2-99 | None |
| A0A183W3K8 | 3-100 | None |
| A0A0D2MAQ3 | 1-103 | None |
| A0A7S0DCD9 | 28-135 | None |
| A0A818BX07 | 1-108 | None |
| A0A0K0DNF1 | 16-110 | None |
| A0A4S2KVH5 | 301-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.