DPCstruct | MC54716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 580 |
|---|---|
| Mean domain length (aa) | 201 ± 34 aa |
| Standard deviation of domain lengths | 34.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.01 |
| Pfam Score | 86.10 |
| Assigned Pfam label(s) | CL0260- CL0198- PF12627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497QKW5 | 17-207 | IPWALSCIEEKFDDALIMLKNNCLIYGGAIRDIIAELPIRGDLDIAIPYNTYNRILSAFDNSSRWVIKNPKLPMAKNNNNNYEGALK… |
| B8KDB0 | 3-154 | LPQCYIAAGFVRNLVWDALHSFDVATPLNDADVIYFAPDENDPKAYLKYESQLNHLMPEINWQVRNQALMHTRNGDLPYASSLDAMS… |
| A0A318YSW4 | 122-330 | None |
| A0A496RGG5 | 33-190 | None |
| A0A7S3ZPD3 | 329-573 | None |
| A0A811MAN8 | 219-430 | None |
| F4Q0L3 | 484-677 | None |
| A0A7X7XDG3 | 8-195 | None |
| A0A166BVD2 | 6-183 | None |
| A0A816PWU4 | 155-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.