DPCstruct | MC5471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 210 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813M6L1 | 2-210 | AKSLKKAYFIWLFGGLFGLHHFYLKRDKQAFIYLTTFGGFLIGFLRDIYRLPEYVREANEDAVYVEKLKKQQEQLKTPLFLTSRFIG… |
| A0A1B6D4B2 | 1-219 | MAKKSVMLTYVLWFVGGFFGIHHFYLGRDIQAFLWWCTLGGYFGLGWLRDIVYIPFYVADANSEPEVVQRFKESIRSHPKPPFSTTR… |
| A0A2A2KBN7 | 7-236 | None |
| A0A6J3EA82 | 2-192 | None |
| A0A6S9LUP3 | 7-192 | None |
| A0A2H2HZ53 | 97-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.