DPCstruct | MC54708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9ZZ50 | 1-98 | SFPDSSNPHTTLPCCAVCLGRNPHRTVECAASRTWDNAFDVFAERIKKALWTKDGRQLCTAWQREEGCSSSQHGNKHLCSGCGLPDH… |
| A0A0D0D7Z4 | 12-110 | AGPPPSLPIILPICAVCLGWHRHSMPVIQCPVKRTWDDKYNTHCERFNKAICTRKGGITLCSLWQHEYGCHKRHDHMHHCSGCGAIM… |
| A0A0D0DAZ8 | 44-135 | None |
| A0A0D0D9C2 | 81-193 | None |
| A0A0D0D8S6 | 2-73 | None |
| A0A0D0D3B7 | 1-85 | None |
| A0A177U8C4 | 482-582 | None |
| A0A177UPC0 | 98-202 | None |
| A0A177V7I9 | 516-614 | None |
| A0A0C2ZG25 | 64-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.