DPCstruct | MC54707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2QXN2 | 1-57 | MILEVDAKYIKDMLNNPDLQPNATINRWIQGILLFTFELRHIPANKHRGPDALSRKE |
| A0A0D0D7T0 | 1-61 | MACSVPLELDAKYVKGMINNPDLQPNVTINRWIAGILLFSFKLVHVPAEKHAGPDGLSRMP |
| A0A4S4LLV1 | 31-88 | None |
| A0A1C7MU04 | 131-186 | None |
| A0A0D0CFS0 | 68-127 | None |
| J4H5I8 | 108-166 | None |
| A0A060SUZ9 | 2-52 | None |
| A0A0L6X3E9 | 1-61 | None |
| A0A0L6WRV1 | 231-284 | None |
| A0A0L6WRD1 | 484-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.