DPCstruct | MC54705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 48 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 59.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0D2R2 | 1-54 | YATRSHQFIDAYQKGLDGKQAVWAARKYHGHRVLPETILHEFDEAQTKLTKQTS |
| A0A0C9UBJ5 | 146-193 | FANRSARFMDGYQRGLTGSQASWANKKYHGHRVLPESIMNDLEAAKVV |
| A0A0D0D5F7 | 3-48 | None |
| A0A4Q9PJ56 | 494-541 | None |
| A0A0D0D6M8 | 1-46 | None |
| A0A0D0CZL6 | 1-46 | None |
| A0A0D0CG80 | 30-75 | None |
| R7SKC9 | 280-327 | None |
| A0A165P953 | 26-73 | None |
| A0A0D0CWX4 | 22-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.