DPCstruct | MC54700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 159 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3E4F6 | 103-253 | MTSVANSLSRLSSTSASFLVSSSPIRSTSHLPQLTTTLISPPRNHDAQLLAHKPKTEYEAQLQAALLRSNNQINLQNETLRAMQAQN… |
| A0A0D0CH69 | 1-160 | WQTTAKDAFDTLASTSAVFLIEKSPLTSADQLPPFIPLLISPMCNLKQKYSLLAEEPRNEKEVTYQTALLEAEACEAQSKVVMLGMQ… |
| A0A0D0D3T1 | 66-217 | None |
| A0A0D0EB49 | 79-246 | None |
| A0A284RVK1 | 1-175 | None |
| A0A0D0CTB7 | 48-206 | None |
| A0A0C3PHZ0 | 42-208 | None |
| A0A5C2TDV7 | 22-185 | None |
| A0A166R936 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.