DPCstruct | MC547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7Y621 | 2-83 | FYILLTGIFQFVYCLLVGTFPFNSFLSGFISTVASFVLASCLRIQVNSENKSQFPEVSPERAFADFIFANCILHLVVVNFLG |
| A0A4U0XWU7 | 76-188 | APRSLQDAQQILLGMWNTYVDKTPQRVKLLDTFMAFLMLVGVLQFVYCVIAGNYPFNAFLAGFSATVGQFVLTASLRIQTNPENEKE… |
| A0A4T0I396 | 506-613 | None |
| A0A1A9VS60 | 7-108 | None |
| A0A2J8AEE3 | 4-101 | None |
| A0A7J6LJC3 | 497-604 | None |
| A0A0R3TMW0 | 20-129 | None |
| A0A6C1E8V9 | 19-125 | None |
| A0A418AT02 | 12-123 | None |
| I7M930 | 20-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.