DPCstruct | MC54699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 166 ± 32 aa |
| Standard deviation of domain lengths | 32.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NE25 | 237-354 | FNEPTMTPKDLAFCQALEEWREREMVESGLGEDDFFGPQLILADGILNRIIAVAHHLKLTDIASLKDQTGWRNSKKYGASIISLFLT… |
| A0A0D0CA87 | 38-215 | KFTEFTSNLSKPPATPPRSRIPKYGRTQHDHTLLDALDGWREQTTATIYGWHHLNDMGPSIMMCNATIECIIDCAHHCMITSVPELK… |
| F8NHW4 | 97-254 | None |
| A0A5K1K289 | 112-345 | None |
| K5VCE8 | 1-110 | None |
| K5V2P6 | 3-143 | None |
| F8NNK7 | 162-301 | None |
| A0A0D0D8V3 | 77-317 | None |
| A0A4Y9ZQJ6 | 53-220 | None |
| A0A4Y9ZV00 | 291-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.