DPCstruct | MC5469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 214 ± 28 aa |
| Standard deviation of domain lengths | 27.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.17 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1I5B6 | 3-186 | TPGPGPKYVLPTLTGFIGHAPTHYRFPSNPMGVRLDKLKKLNYTPAPNKYDIRELTRYGTSTRPTCVLGIKPKIKYNISPGPNKYAP… |
| A0A1B6CX82 | 1-227 | MDVKPLGPGPNYPLPSTVGFEHHDPTRNRAPAFSLGSRKFDICKKLISPAANVYNPIKFTRFGLTTTQANSLGPKLPISNKTVSPGP… |
| T1EX70 | 49-275 | None |
| A0A6J1WHE5 | 2-165 | None |
| A0A1B0BZQ2 | 5-224 | None |
| A0A1I8IRN5 | 3-244 | None |
| H0ZNE4 | 131-381 | None |
| A0A340XXT7 | 10-201 | None |
| A0A4U1EMZ3 | 10-191 | None |
| T1JFY2 | 9-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.