DPCstruct | MC54685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 254 |
|---|---|
| Mean domain length (aa) | 190 ± 26 aa |
| Standard deviation of domain lengths | 25.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.40 |
| Pfam Score | 99.43 |
| Assigned Pfam label(s) | PF06695- PF09335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535E0L2 | 36-239 | EVVNSAITVVDAVASLPPALLYLVIVVWLSVESAAVPLPNEAILQFSGFLVGAGHLNLFVALAASVLGTITGATFSWYVARRFGPAG… |
| A0A537VFN1 | 222-409 | KPPVLDRVAALARSRSGLWLVFGWAVAEALLWPIVPDVPVVLLAAAAPSRFIPLAATATAGSIAGGALGYALGAAGAGGFVLAHAPL… |
| A0A7W1BJ07 | 20-204 | None |
| A0A1R0KUQ9 | 5-203 | None |
| A0A7S9YNL3 | 208-403 | None |
| A0A1V4WQV5 | 5-183 | None |
| A0A1N7FY92 | 56-218 | None |
| A0A2W1ADE1 | 137-304 | None |
| A0A3L7W5V8 | 10-203 | None |
| A0A1B0A7C6 | 336-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.