DPCstruct | MC54683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 661 ± 52 aa |
| Standard deviation of domain lengths | 52.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535DQ41 | 2-607 | TATTRMLVVKPDDGSGTTGNGGGTSSNLPTVTEAADALAAALQSPIGYLFLDRTRIRPTGFAVGEHVFALSLAPGEEVTLEQKTYSK… |
| A0A2Z4MS24 | 91-769 | DEALAALAERYESLTAGVLSPVGLVNLFREYFFEFDTFLGAPAGHIWVSPGGTVEVIETSTRRTLVEKVAEQTEEISRKTEDTLTDQ… |
| A0A679HXP6 | 248-893 | None |
| A0A5C8A9D2 | 10-641 | None |
| A0A3N1PPL4 | 205-816 | None |
| A0A4R1RM22 | 201-933 | None |
| A0A1I5FJB3 | 154-899 | None |
| A0A315BSU2 | 399-1056 | None |
| A0A0D6TMX0 | 80-741 | None |
| A0A1B9Y6V9 | 2-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.