DPCstruct | MC5468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077XMN5 | 1-114 | MPYQTVFVEFYDQIISSINQGTFAKLTLAKTMGDTELKNIYVRLHILDTGGYNFALTLKYKTEEIEHFHSVDEALTVLSSYIKNPFT… |
| A0A1L8N088 | 4-124 | FELLLPTIISQIETCTLSNPKKDVKYLKITIRRNKECNAAKENCFFIERFTQKQAFQKSLTETETANLLLLETGIHYKNVAIFTETE… |
| A0A1V6DLP7 | 4-125 | None |
| A0A1Q6SIV0 | 4-101 | None |
| L1IEW2 | 20-131 | None |
| A0A2V8R0E6 | 6-121 | None |
| A0A482SS63 | 50-198 | None |
| A0A3D1XAS9 | 12-114 | None |
| R0AP00 | 5-123 | None |
| A0A855HWU1 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.