DPCstruct | MC54675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 279 ± 45 aa |
| Standard deviation of domain lengths | 44.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376RPU8 | 10-302 | RVTEIDRLLEQKPRLTADQAWDVIRQTSRKDLNLRLFLPTLQAATSGLTQSDPRRQLVDTLTRWDGINLLNYDGKTWQQPGSAILNV… |
| A0A2G8DGC0 | 143-401 | RSIRLYEPLDDQNEFTFESFSEIHRDNVSAIARDFLSLAGILSEKNLLSQNSTRLLNALSDWDYRLLKNSRAADVAETVVREMHRSP… |
| A0A3B9XEI2 | 31-295 | None |
| A0A2T2UEM6 | 181-453 | None |
| A0A395LVL4 | 526-811 | None |
| A0A2V7KEE5 | 723-997 | None |
| A0A1V5Z5J2 | 23-293 | None |
| A0A418W9A2 | 411-719 | None |
| A0A2V7WUJ9 | 118-419 | None |
| A0A1F8PB66 | 169-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.