DPCstruct | MC54663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 207 ± 49 aa |
| Standard deviation of domain lengths | 48.95 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366S5I5 | 5-184 | DFDFWDSDGYLTGKDVSDEQRNTLYNLLNKDYGATDVLESFPFLIIGCSGGPPDKKKRPFSVAGAIAIWRDAEHFDFRPIVGDLGQG… |
| A0A094FDD4 | 1-184 | MASQSVTAHPEHITLPFDLQVDPDAFHEPENMELLMSLFPGNLGLSMDGVFLYFLQKKIPSKPWPKSVGGLPPYFAPEMGRQYMPRL… |
| A0A5N5PGR6 | 13-232 | None |
| A0A1B8CRC8 | 4-191 | None |
| A0A0F8WLM5 | 9-279 | None |
| A0A1L9VJ04 | 1-224 | None |
| V9D633 | 62-273 | None |
| A0A0U5CNE3 | 11-167 | None |
| A0A2T3B120 | 37-261 | None |
| A0A177AG56 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.