DPCstruct | MC54651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LF02 | 2-100 | PKYEGQLYAYFLFSQGHGYPLWVPEPNTQLPAAYADEGIRIGDVGIITRNGGFDFLFNICLPVDHPVNQHYGTPPGFTPLICDRHTF… |
| A0A0W0F3D7 | 5-85 | GQLYARLLFPLGHGHALWLPEPNDDLPPEYSDKGIQIGDLGVITPDGGFDFFFNVCVSADHPINRSRGTPANFVPIAWNGQ |
| A0A2H3C112 | 19-100 | None |
| A0A0C2Y487 | 70-165 | None |
| A0A6A4GGT9 | 61-140 | None |
| A0A6A4GNS8 | 60-144 | None |
| V2W3X3 | 52-130 | None |
| V2WJM8 | 1-83 | None |
| V2WNS1 | 64-148 | None |
| E2LVP3 | 35-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.