DPCstruct | MC54650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 175 ± 28 aa |
| Standard deviation of domain lengths | 28.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LCL3 | 6-207 | RTIRLPTDKEVDPEIQPFVKSGMDFCMETLLNLTPDERNRTREMLKRNKVTYFRQALDAMGREDDVDEAFWYALDKVDFFPRPWEKQ… |
| A0A4V4HIG7 | 8-150 | GTWMQNMLQQWGWDDFKLDPAVVFAMDNVDFHPRPWEGLLSKVEGNKRMQEWNAAVDEYIKTPGDTRNRIDIEIEAKIGPHGGPLYR… |
| A0A2H3BWJ3 | 120-344 | None |
| A0A4Y7QAC6 | 219-369 | None |
| A0A4Y7QAG9 | 24-200 | None |
| A0A401H0G0 | 31-236 | None |
| B8PAA6 | 298-481 | None |
| M2P7Q1 | 58-244 | None |
| A0A4S4M5J9 | 23-162 | None |
| A0A4Y9YSQ8 | 338-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.