DPCstruct | MC54649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LBR3 | 6-114 | GISASRLEILEERLRDDVISELNAFGGRLLLHSETEDGTVIPVWEDVQPSDVVVLKDIMECRRDAYGIELVYDRIPITAEAPPDFAD… |
| A0A7J9BL94 | 115-220 | LEYTGINRDRVEQMEARLKEDILMEAARYGNKILVTDELPDGQMVDLWERVSCDSVKTPLEVYEELQLKGYLVDYERVPITDEKSPK… |
| A0A7J8M5X5 | 30-138 | None |
| A0A5J5UPE7 | 73-175 | None |
| A0A835IQI8 | 479-599 | None |
| A0A3S3N9Q7 | 289-409 | None |
| A0A438D111 | 184-305 | None |
| X6P2C3 | 19-132 | None |
| A0A6S7MJZ3 | 63-140 | None |
| A0A177TEH0 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.