DPCstruct | MC54644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A663N1J4 | 6-117 | NIEMHKQAEIVKRLSAICTQIVPFLTQEHQQQVLQAVERAKQVTVGELNSIVGQQQLQHLSHHASPIPLTPHPSSMQPSSLPGPPGP… |
| A0A1S3FP06 | 222-315 | RHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELSLSALGSQAHLSKEDKNGHDGDAHPD… |
| E9IDF8 | 1-141 | None |
| A0A672JUV9 | 53-186 | None |
| A0A672ZZ49 | 1-101 | None |
| A0A834JU46 | 106-255 | None |
| A0A1S3FNT8 | 66-195 | None |
| A0A4Z2H1I1 | 87-183 | None |
| A0A2J8WPG8 | 73-188 | None |
| A0A816HGX3 | 66-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.